Slc38a5 anticorps (N-Term)

N° du produit ABIN635377

Cet anticorps Lapin Polyclonal détecte spécifiquement Slc38a5 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Slc38a5 anticorps (N-Term) (ABIN635377)

Antigène: Slc38a5 (Solute Carrier Family 38, Member 5 (Slc38a5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Slc38a5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Slc38a5 anticorps

Épitope: N-Term

Specificité: SLC38 A5 antibody was raised against the N terminal of SLC38 5

Purification: Affinity purified

Immunogène: SLC38 A5 antibody was raised using the N terminal of SLC38 5 corresponding to a region with amino acids GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC38A5 Blocking Peptide, (ABIN938729), is also available for use as a blocking control in assays to test for specificity of this SLC38A5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Slc38a5

Antigène: Slc38a5 (Solute Carrier Family 38, Member 5 (Slc38a5))

Autre désignation: SLC38A5

Sujet: The protein encoded by this gene is a system N sodium-coupled amino acid transporter involved in the transfer of glutamine, asparagine, histidine, serine, alanine, and glycine.

Poids moléculaire: 51 kDa (MW of target protein)